PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009621552.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 242aa    MW: 28126.4 Da    PI: 4.6013
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009621552.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.95.5e-5561331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv++yLk+k++g+++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++v 
  XP_009621552.1   6 LPPGFRFHPTDEELVNYYLKRKIHGQEIEL-DIIPEVDLYKCEPWELAeKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVS 99 
                     79****************************.99**************84335556888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     s +++++g+kktLv+y+grap+g +tdWvmheyrl
  XP_009621552.1 100 S-QNRAIGMKKTLVYYRGRAPQGIRTDWVMHEYRL 133
                     9.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-644157IPR003441NAC domain
PROSITE profilePS5100560.2876156IPR003441NAC domain
PfamPF023652.6E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKIHG QEIELDIIPE VDLYKCEPWE LAEKSFLPSR  60
DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVSS QNRAIGMKKT LVYYRGRAPQ  120
GIRTDWVMHE YRLDDKECDE ISSIQDSYAL CRVFKKNGVC SEIEELGQPS TVPSFEYPLT  180
QSINVHEYET TSPDVPLASS SCMEEEEEEK DDSWMQFITE DAWCSSNSPF QGEEISPLAF  240
TN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-56215611168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009621552.10.0PREDICTED: NAC domain-containing protein 74 isoform X2
RefseqXP_016441522.10.0PREDICTED: NAC domain-containing protein 86-like isoform X2
SwissprotQ9FFI53e-89NAC86_ARATH; NAC domain-containing protein 86
TrEMBLM1D2D81e-163M1D2D8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000797491e-163(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-131NAC domain containing protein 57